ortho home defense ingredients

- Painted Lady Developed by Rubel, Wagner Flexio 590 Review: The Complete Painting Solution. - Crickets - Black Turfgrass Ataenius Eliminator Insect Control active ingredient. - Apple Maggot On fabric and carpet, it leaves a dry residue for two weeks, so any bed bugs that come out of hiding and make contact with the chemicals should be killed. Ortho Home defense spray (insecticide) says on the label that it is safe for pets and children once the spray is dry. One of the most annoying problems that a home can have is insect infestation. ortho home defense indoor & outdoor insect killer bifenthrin ; raid yard guard outdoor fogger formula vii permethrin ; nix lice treatmentpermethrin ; bayer lawn & garden multi-insect killer - Brown Recluse - VariegatedMEALYBUGSMIDGESMILLIPEDESMITES - WolfSPITTLEBUGS 1. NOTE: EPA Reg. The active ingredient in this product is Permethrin, which will effect the nervous system causing paralysis. Ortho Home Defense MAX Insect Killer for Indoor & Perimeter 1 kills ants, roaches and spiders indoors on nonporous surfaces. 3. Application: - Alder Ortho Home Defense active ingredients. © 2020 The Scotts Company LLC. - Cranberry Fruitworm 99 (17) View Wishlist Added to Wishlist Ortho Home Defense Max Ant Eliminator, 709-mL $9. – Dries fast Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. Deltamethrin 0.02%. Active Ingredients: 0.20% Tetramethrin, 0.20% Phenothrin Ortho® Home Defense® Flying Insect Killer kills listed insects both indoors and out. The Ortho® Guarantee: If for any reason you, the consumer, are not satisfied with this product, mail us your original proof of purchase to obtain a full refund of your purchase price. Adam, the active ingredients in the Ortho Home Defense Max Bed Bug, Flea & Tick Killer affect the insects' nervous system. NOTE: EPA Reg. While it will control all stages of bed bugs, it will not control all stages of fleas, tickets or other insects listed. 0.05% Bifenthrin 0.0125% Zeta-Cypermethrin. Simply snap open the traps and let the pre-loaded active liquid ingredients work their magic on that pesky colony and its queen. Ortho® Home Defense Insect Killer for Indoor & Perimeter with Comfort Wand® delivers a potent bug barrier. Ortho Home Defense comes in a half-gallon container with a battery-powered continuous spray wand. Zeta-Cypermethrin 0.0125. - Squash BugLEAFHOPPERSLEAFMINERS • Very long-lasting One of the most common questions regarding Ortho Home Defense Max is whether it is safe for kids and pets. That’s exactly why Ortho Home Defense Max is very handy and useful – it is able to combat more than 130 kinds of insects. It kills insects, including fleas, ticks, spiders and more, outside the home before they can come inside plus it starts creating a bug barrier in just … There presently are … ORTHO HOME DEFENSE MAX INDOOR INSECT BARRIER . It uses two active ingredients, which are bifenthrin 0.05% and zeta-cypermethrin 0.0125%. According to the manufacturer, Ortho Home Defense Max can last for about 12 months if left undisturbed. - European Pine It should not be touched if it hasn’t dried yet, so you should keep your kids and pets away from the treatment while it is still drying. Ortho will probably realistically only give you 30 days of protection. at Amazon.com. It is pretty powerful and effective. - DogFLIES 5. - Elm Leaf The manufacturer claims that it is safe if used according to the label. - SouthernCOCKROACHES - Buckhorn away from you. Active ingredients in Ortho’s bed bug spray include: 4% Sumithrin. - Carpet Insect Killer for Indoor and Perimeter refill. Hold sprayer 12 inches from surfaces being sprayed. With this very spray, you will be able to eliminate more than 130 different kinds of insects. Shake well. – An extended reach wand with multiple spray settings Don’t just kill bugs; create a bug barrier with Ortho Home Defense MAX Insect Killer Granules. Ortho Home Defense Max has a formula that combines a 0.05 percent concentration of bifenthrin, the active ingredient, with 0.0125 percent concentration of the inactive ingredient, zeta-cypermethrin. – 10.36 lbs, Ortho Home Defense Max Review: Pros Spray a 12-inch barrier around doors and window trim for up to 3 months of control. - Pecan Scorch Ortho Home Defense Max: Product Details Pet-safe: Now i am wondering if i should try to mop it up, or if it is truly okay for my pets. Eliminator is only $5/gallon, but I was purchasing the Ortho last year from Walmart for $5/gallon. For use in: No. Apply as a perimeter treatment along foundations. Find helpful customer reviews and review ratings for Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand - Kills Ants, Cockroaches, Spiders, Fleas, Ticks & Other Listed Bugs, Creates a Bug Barrier, 1.1 gal. Always read and follow the product label before use. The bottom line is bed bugs aren’t universally resistant to pyrethroids. - WalnutBEESBEETLES Deltamethrin 0.02%. - Oblique Banded Box 190 Marysville, Ohio 43040 United States ORTHO HOME DEFENSE MAX INSECT KILLER FOR INDOOR & PERIMETER 1 Section 1. It should dry within a couple of hours of application, though the directions state that it could take as long as 6-8 hours before becoming fully safe to use. - Black Widow Once it has dried though, it can last for a long while. Apply a 4-inch barrier around wall perimeters, washers, and driers. Ortho Home Defense. Ortho Ant B Gon Max Ant Killer Bait (6-Pack) Give ants their marching orders with new Ortho Ant B Gon Ant Killer Bait. - Squash Vine – Yes, if used as directed on label - Pecan - Brown Soft The Ortho Home Defense Max 1.33 Gal. Product Name: Ortho® Home Defense™ Max™ No-Pest® Insecticide Strip Revision Date: 2006-08-24 Page # 2 of 7 Section 3: Hazards Identification Appearance, Colour and Odour: Solid, yellow plastic strip, slight odour upon opening the sealed pouch Primary Route(s) of … - Codling - Pine Chafer (grub)  – Hold sprayer 12 inches from the surface - Sod Webworms Save my name, email, and website in this browser for the next time I comment. - Bagworms 4. - Greenbug It is intended for both indoor and outdoor use and … It takes pretty long to dry, but it is safe for kids and pets once it has dried. 2. - Pecan Nut Casebearer skin contact is not toxic but ingestion is. Ortho Home defense spray (insecticide) says on the label that it is safe for pets and children once the spray is dry. Whether you have ants, spiders, centipedes, or other [Bracketed information is optional text]. : 239-2633c pn: 6061 2. composition / information on ingredients 3. hazards identification emergency overview immediate concerns: causes moderate eye irritation avoid contact with eyes or clothing keep out of reach of children. Find helpful customer reviews and review ratings for Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand - Kills Ants, Cockroaches, Spiders, Fleas, Ticks & Other Listed Bugs, Creates a Bug Barrier, 1.1 gal. Do not spray animals. That’s where Ortho Home Defense Max may help. 99 (8) View Wishlist Added to Wishlist Wilson Home Pest … ORTHO HOME DEFENSE MAX INDOOR INSECT BARRIER . My cat may have ingested a small amount of ORTHO Home Defense - Answered by a verified Cat Veterinarian We use cookies to give you the best possible experience on our website. Given that Ortho Home Defense is safe to be around after it dries, that begs the question of just how long it takes to properly dry. Identification . [Bracketed information is optional text]. - Japanese (Adults) – Bifenthrin: .05% - Pecan StemPILLBUGS & ROLLIE POLLIESPLANT BUGS - Diamondback Ortho Home Defense comes in a half-gallon container with a battery-powered continuous spray wand. - Green Cloverworm • Quite powerful and effective for killing insects To Kill and To Repel Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho to keep them out. - Peachtree - Argentine - Hairy 239-2699 Bold, italicized text Is Information for the reader and Is not part of the label. - Peach Twig - American/Palmetto Bug Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand easily kills indoor pests, including ants, cockroaches, spiders, fleas and ticks. Purpose of product. Purpose of product. both have low toxicity towards mammals (humans). Set spray nozzle to outdoor setting. In most cases, it is best to leave the treatment to dry for about 24 hours. My cat may have ingested a small amount of ORTHO Home Defense - Answered by a verified Cat Veterinarian We use cookies to give you the best possible experience on our website. Use with confidence in kitchens, bathrooms and throughout the house to kill common indoor pests, with no staining or odors. Special Features: Ortho Ant B Gon Max Ant Killer Bait (6-Pack) Give ants their marching orders with new Ortho Ant B Gon Ant Killer Bait. - Foraging Fire Ants - VegetableLEAFROLLERS - GypsyPERIODICAL CICADAPHYLLOXERA Ortho Home Defense Max is able to kill insects that get in contact with it. - Black Cherry - Artichoke Plume - Flea - Sap The durability is excellent. - Mexican Bean Don’t just kill bugs; create a bug barrier with Ortho® Home Defense® Insect Killer for Indoor & Perimeter Refill2. 05% Imidacloprid. Don’t just kill bugs; create a bug barrier with Ortho Home Defense MAX Insect Killer Granules. If you have any further questions or would like further assistance, please contact us at 877-220-3089 and one of our representatives would be glad to assist you. Ortho Home Defense Insect Killer for Lawns Granules provides 3-months of protection* from bugs for you and your family. - Asian Talstar is definitely the professionals version. This is a … - Oriental - Rosy Apple Safety Data Sheets can be found at scottsmsds.com. 75% (±) cis and min. Use with confidence in kitchens, bathrooms and throughout the house to kill common indoor pests, with no staining or odors. GHS product identifier : ORTHO HOME DEFENSE MAX INDOOR INSECT BARRIER Product type : Pesticide SDS # : 320000012123 EPA Registration Number: : 239-2699 . - Chigger 5. - FirebratsFLEAS Is Ortho Home Defense kid and pet safe? Whether you have ants, spiders, roaches, or other home-invading insects as listed, you can count on Ortho® to keep them out. That’s quite impressive. Safety It kills eggs, nymphs, and adult bed bugs, including ones that are pyrethroid-resistant. I have already sprayed most of the house, and have left my animals locked up in a separate room of the house. – Apply a 4” band along the interior or 12” band along the exterior perimeter of the home And on the other hand, the Ortho Home Defense is bifenthrin concentrated chemical that strongly works against keeping most of the insects such as roaches, ants, spiders, etc. The Ortho Group P.O. Whether you have ants, spiders, roaches, or other home-invading insects as listed, you can count on Ortho® to keep them out. Kills spiders including black widow, brown recluse, hobo, and wolf spiders. Usage: ... chemicals associated with products in this database may be viewed by selecting the "Advanced" button on the Chemical Ingredients tables. Active Ingredients is listed as 0.05% Bifenthrin (MSDS)- It is virtually insoluble in water so it has high persistence in soil (half life = 7 days – 8 months) and consequently it is one of the longest residual termiticide, which can be good or bad. - PecanSPRINGTAILSSTINK BUGS - European Red - Pickleworm • Safe for kids and pets after 24 hours. On fabric and carpet, it leaves a dry residue for two weeks, so any bed bugs that come out of hiding and make contact with the chemicals should be killed. Apply a 4-inch barrier around window trim and door trim. Active Ingredients: 0.20% Tetramethrin, 0.20% Phenothrin Ortho® Home Defense® Flying Insect Killer kills listed insects both indoors and out. There are some factors and conditions that may hasten the drying process, though. - Euonymus no. Ready-to-Use Perimeter and Indoor Insect Killer is designed for interior and exterior use to kill ants, roaches, spiders and other pests and to help keep new ones from entering your home. - Tentiform - Red/Western HarvesterAPHIDS How to use and dangers of Ortho Home Defense spray? Eliminator Insect Control active ingredient. - Cornsilk - American Plum The Scotts Company, LLC, manufactures Ortho products, while Chemisco, a division of United Industries Corporation, makes Spectracide products. - Tent skin contact is not toxic but ingestion is. Still, in most cases, it is able to repel them so that they don’t get into your personal space. - Armyworms (Beet, Fall, Southern, True, Yellow Striped, Beet Armyworm Eggs)  Ortho Home Defense Indoor and Outdoor Insect Killer2 99 (30) View Wishlist Added to Wishlist Wilson Home Pest Control, 1-L $9. Spray a 12-inch barrier around patio and deck perimeters for up to 3 months of control. Ortho Home Defense Insect Killer for Lawns Granules provides 3-months of protection (refer to back panel for insects controlled for 3 months) from bugs for you and your family. Products containing bifenthrin include Transport, Talstar, Maxxthor, Biforce, Capture, Brigade, Bifenthrine, Ortho Home Defense Max, Bifen XTS, Bifen IT, Bifen L/P, Torant, Zipak, Scotts LawnPro Step 3, Wisdom TC Flowable, FMC 54800, Allectus, Ortho Max Pro and OMS3024 and mega wash from green planet and in Australia, Fortune Ultra and Hovex Ultra Low Odor. It is suitable for indoors and outdoors. By continuing to use this site you consent to the use of cookies on your device as described in our cookie policy unless you have disabled them. - Colorado Potato Ortho Home Defense Max Indoor & Perimeter Insect Killer2 Ortho® Home Defense Max Home Insect Killer2 ... Other Ingredients: 99.9375% 100.0000% 1 Cis isomers 97% min, trans isomers 3% max 2 Cis/trans ratio: Max. Bifenthrin 0.05. A pyrethroid is an organic compound similar to the natural pyrethrins, which are produced by the flowers of pyrethrums (Chrysanthemum cinerariaefolium and C. coccineum).Pyrethroids are used as commercial and household insecticides.. • Has repelling power By continuing to use this site you consent to the use of cookies on your device as described in our cookie policy unless you have disabled them. - Budworms Apply a 12 inch band along the exterior perimeter of your home in areas where insects are a recurring problem. - Two Spotted Spider (Adult)  - Lygus Bug - Apple - Broad Spray until slightly wet, without soaking. This insecticide is also able to keep those nasty insects at bay. Shipping Weight: So - best recommendation - spray when the air is still - … Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. Target pests: – Spray until slightly wet, without soaking In general, it is more powerful for dealing with the smaller insects and less powerful for the bigger ones. 239-2699 Bold, italicized text Is Information for the reader and Is not part of the label. It uses two active ingredients, which are bifenthrin 0.05% and zeta-cypermethrin 0.0125%. Spray a 12-inch barrier around perimeters and foundations for up to 3 months of control. - HouseFUNGUS GNATSGRASSHOPPERSHORNETSLACE BUGSLEAFFOOTED BUGS - Striped Cucumber Weevils (Annual Bluegrass & Black Vine) BORERS Shake well. However, the power of Ortho Home Defense Max seems to vary on different kinds of insects. Outdoors, it can be used on ornamental plants to control insects including aphids, white flies and Japanese Beetles. It should dry within a couple of hours of application, though the directions state that it could take as long as 6-8 hours before becoming fully safe to use. Need an answer to a product question? Simply snap open the traps and let the pre-loaded active liquid ingredients work their magic on that pesky colony and its queen. All rights reserved.Powered by WordPress. 25% (±) … Thank you for your question regarding Ortho Home Defense Max Insect Control. Ortho Home Defense Indoor and Outdoor Insect Killer2 I know to spray around the entrances and crevices around walls..but I would like some more direction on safety. both have low toxicity towards mammals (humans). Create a bug barrier with - KudzuSTORED PRODUCT PESTSTHRIPSTICKSTERMITESWASPSWHITEFLIESYELLOWJACKETS. - Green Fruitworm - Earwigs - Southwestern Corn 9 % bifenthrin, and Ortho typically has. Hello, I am spraying for the first time ever. Read honest and unbiased product reviews from our … - Filbertworm Ortho Home Defense Insect Killer for Lawns Granules provides 3-months of protection* from bugs for you and your family. It kills insects, including fleas, ticks, spiders and more, outside the home before they can come inside plus it starts creating a bug barrier in just minutes. Scotts experts are always available by email and phone in our Help Center. Copyright © 2020 Homeverity.com. Buy online and get it shipped to your door. 99 (8) View Wishlist Added to Wishlist Wilson Home Pest Control Battery Powered Sprayer, 3-L - Pea - Hornworms (Tobacco & Tomato)  In household concentrations pyrethroids are generally harmless to humans. However, note that it needs to be applied on a dry area. Ortho Home Defense MAX Insect Killer for Indoor & Perimeter 1 kills ants, roaches and spiders indoors on nonporous surfaces. - California Red - Billbugs 3. Do not apply this product, or allow it to drift, to blooming plants if bees are visiting the treatment area. Apply a 4 inch band along the interior of your home in areas where insects are a recurring problem. In this Ortho Home Defense Max review, we will take a look at a great solution for your home’s insect issues. - Redheaded PineSCALES - Rindworm Do not apply this product in or on electrical equipment due to the possibility of shock hazard. Talstar will typically give 60 to 90 days. - Cherry Fruit Talstar contains 7. - Blueberry Spanworm Apply a 4-inch barrier around baseboards, cabinets, and windows. - European Corn In the house, it can be used to control insects including flies, gnats and mosquitoes. Identification GHS product identifier : ORTHO HOME DEFENSE MAX INSECT KILLER FOR INDOOR & PERIMETER 1 Product type : Pesticide SDS # : 320000005718 EPA Registration Number: : 279-9534-239 – Residential (Indoors & Outdoors), Family Rooms, Bathrooms, Bedrooms, Kitchens, Pantries, Garages, Basements, Attics, Closets, Storage Areas, Perimeter Foundations, Doors and Windows, Patios and Decks Unlike many bed bug sprays out there, it doesn’t rely on pyrethroids alone. Ortho Home Defense active ingredients. - Navel Orangeworm • Suitable for various kinds of insects No. A detailed review of the Ortho Home Defense Indoor & Outdoor Insect & Roach Killer along with our in Roach Sprays Buying Guide. Eliminator is only $5/gallon, but I was purchasing the Ortho last year from Walmart for $5/gallon. at Amazon.com. Ortho Home Defense Max kills bugs inside, keeps bugs out. Ortho Home Defense and its active ingredients are EPA-registered and safe to use around for yourself, your kids, and pets such as cats and dogs. Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand easily kills indoor pests, including ants, cockroaches, spiders, fleas and ticks. Conclusion – Zeta-Cypermethrin: .0125% You can try to touch it with a finger to see if it has dried yet. This is a synthetic pyrethroid. - Pyramid INDOORS: 75% (±) cis and min. Don’t just kill bugs; create a bug barrier with Ortho® Home Defense® Insect Killer for Indoor & Perimeter Refill2. In the house, it can be used to control insects including flies, gnats and mosquitoes. Hold sprayer 12 inches from surfaces being sprayed. - Cat It uses Bifenthrin as its active ingredient which effectively kill insect pests like ants, cockroaches, centipedes, earwigs, fleas, ticks, millipedes, silverfish, spiders, and other listed insects. - Two Spotted Spider (Eggs) MOLE CRICKETSMOSQUITOESMOTHS - San JoseSCORPIONSSILVERFISHSOWBUGSSPIDERS Active Ingredients is listed as 0.05% Bifenthrin (MSDS)- It is virtually insoluble in water so it has high persistence in soil (half life = 7 days – 8 months) and consequently it is one of the longest residual termiticide, which can be good or bad. Text separated by I denotes and/or options.Highlighted+unde~ined text is new. - European Crane (Adult)  Shop ORTHO Home Defense Max Insect Killer Granules 2.5-lb Insect Killer in the Animal & Rodent Control department at Lowe's.com. 05 % bifenthrin. Its active ingredients are Sodium Lauryl Sulfate (= SLS) together with geranium oil and peppermint oil. - Hickory Shuckworm Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. Invest in insect control that works. – Odor-free KILLS: ADELGIDS - Pine Shoot - Imported Cabbageworm Loopers (Alfalfa, Cabbage, Celery)  It takes about 24 hours to dry properly; during this duration, it should be protected and undisturbed. World rights reserved. Bifenthrin 0.05. - StalkBOXELDER BUGSBRISTLETAILSCATERPILLARS Available at your local TSC Store! - Corn Rootworm (Adults) Do not spray into air. Active ingredients in Ortho’s bed bug spray include: 4% Sumithrin. - Curculio (Cow Pea, Plum) Text separated by I denotes and/or options.Highlighted+unde~ined text is new. Kills Roaches, Ants and Spiders by Contact, Create a 12-Month Barrier for Ants, Roaches and Spiders: Spray on Indoor Non-Porous Surfaces, Create a 3-Month Barrier Against Outdoor Bugs - Apply as a Perimeter Treatment, Ortho® Home Defense Insect Killer For Indoor & Perimeter, For Refill, just plug in the Comfort Wand® and it's ready to spray, Up to 12-month protection (against ants, roaches and spiders indoors on nonporous surfaces), Kills all common listed household bugs (see product label for complete list of insects), Common Outdoor Bugs and How to Deal with Them, Controlling Pests on Flowers, Roses & Ornamental Plants. Kills 130+ other insects including stink bugs, beetles, earwigs, fleas, house centipedes, millipedes, scorpions, silverfish, and ticks. Ortho Home Defense Max Pull-N-Spray, 5 L Battery Powered $39. Ortho Weed-B-Gone is a commonly used weed killer that kills more than 250 different varieties of broadleef weed without killing the surrounding grass. - Lesser Peachtree - Biting Flies Ortho 1.1 Gallon, Bonus Size, Ready To Use Wand, Home Defense Max Insect Killer, Kills Existing Bugs & Prevents New Bugs From Entering The Home In 1 Application, With Invisishield Barrier Technology New Applicator, The Easy Way To Spray, No Bending, Pumping Or Hand Fatigue, 1 Touch Continuous Spray, Ergonomic Handle, Extended Reach Wand With Multiple Spray Settings. Shop ORTHO Home Defense Max Insect Killer Granules 2.5-lb Insect Killer in the Animal & Rodent Control department at Lowe's.com. Section 1. - Clover If you’re looking for a versatile way to attack your bed bug infestation, Ortho Home Defense Bed Bug Killer is a top choice.The 1.5 gallons of quick-acting solution will kill bed bugs on contact. Apply indoor or outdoors according to label instructions. Ortho Home Defense Max Indoor & Perimeter Insect Killer2 Ortho® Home Defense Max Home Insect Killer2 ... Other Ingredients: 99.9375% 100.0000% 1 Cis isomers 97% min, trans isomers 3% max 2 Cis/trans ratio: Max. Ortho Home Defense Insect Killer for Indoor & Perimeter Refill 2 Don't just kill bugs; create a bug barrier Don't just kill bugs; create a bug barrier with Ortho Home Defense MAX. - Eastern SprucegallANTS Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho Home Defense to keep them out. However, please don’t use it around aquatic life like fish. – Non-staining Ortho Home Defense Max is able to kill insects that get in contact with it. - Rose Read honest … Satisfaction is guaranteed or … “For long lasting residual control leave spray undisturbed. Is it really safe for cats and dogs? For Indoors and Outdoors – Ants, Centipedes, Cockroaches, Earwigs, Fleas, Millipedes, Scorpions, Silverfish, Spiders, Ticks and others *(see the label for a complete list) - Lady Beetles (including Asian Lady Beetle Eggs)  It is effective for dealing with various kinds of insects. - Waterbug - Alfalfa This insecticide is also able to keep those nasty insects at bay. Zeta-Cypermethrin 0.0125. 2. And on the other hand, the Ortho Home Defense is bifenthrin concentrated chemical that strongly works against keeping most of the insects such as roaches, ants, spiders, etc. - TarnishedPSYLLIDS - German The combination is effective for targeting various kinds of insects, including the most common problems such as ants, cockroaches, fleas, earwigs, millipedes, spiders, ticks, and centipedes. This product features a sprayer for application of … Kills American cockroaches, palmetto bugs, water bugs, Asian cockroaches and German cockroaches. 1. The Eco Defense Organic Home Pest Control Spray is made with safe, all-natural ingredients. - Spotted Cucumber / Southern Corn Rootworm (Adults)  This is not the product label. With this very spray, you will be … So - best recommendation - spray when the air is still - … GHS product identifier : ORTHO HOME DEFENSE MAX INDOOR INSECT BARRIER Product type : Pesticide SDS # : 320000012123 EPA Registration Number: : 239-2699 . - PearSAWFLIES My wife found this product a few years ago and we have been using it ever since. The problem is, there are many different kinds of insects that are too hard to deal with individually. Section 1. Create a bug barrier with Ortho 220910 Home Defense Insect Killer for Indoor & Perimeter2. People and pets may enter treated areas after spray has dried. Identification . Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand is specially formulated to help prevent and control home invading insects for up to 12 months. Kills carpenter ants, foraging fire ants, lawn ants, Argentine ants, pavement ants, pharaoh ants, pyramid ants, and red/western harvester ants. away from you. - Pharaoh/Sugar 99 (17) View Wishlist Added to Wishlist Ortho Home Defense Max Ant Eliminator, 709-mL $9. - Red-Banded Given that Ortho Home Defense is safe to be around after it dries, that begs the question of just how long it takes to properly dry. - Pecan Leaf If you are looking for an all-in-one solution for your home’s insect issues, Ortho Home Defense Max is a great solution. - Brown Marmorated Invest in insect control that works. Product Name on Label: Ortho home defense max termite and destructive bug killer The EPA Registered Name for this product is: Talstar 2.4% me insecticide/miticide This occurs when a single registered product is sold using many different names. To touch it with a finger to see if it has dried more direction on.... And get it shipped to your door with one touch you can kill and to Repel Ortho Home Defense Pull-N-Spray! Are Bifenthrin 0.05 % and zeta-cypermethrin 0.0125 % American cockroaches, palmetto bugs, including ones that are hard!, hobo, and driers Max 1.33 Gal fleas, tickets or other home-invading insects, you are encouraged repeat... Kinds of insects at Lowe's.com: from the Ortho Home Defense Max kills bugs inside, keeps out. And/Or options.Highlighted+unde~ined text is new should be protected and undisturbed treated areas after has. Label before use the reader and is not part of the house like more. You wash your hands after using or touching Ortho Home Defense Insect for. To contact water supplies in Ortho ’ s bed bug spray include: 4 %.... & Roach Killer along with our in Roach sprays Buying Guide eliminate more than 130 different kinds of.... And protect against pests ; create a bug barrier with ortho® Home Defense® Insect Killer for Lawns Granules 3-months! Is Insect infestation label that it is able to eliminate more than different. Product to contact water supplies other insects listed you have ants, spiders roaches! Box 190 Marysville, Ohio 43040 United States Ortho Home Defense Max Pull-N-Spray, L! * from bugs for you and your family dealing with the smaller insects and less powerful dealing... Useful – it is intended for both Indoor and Outdoor use and dangers of Home. Safety one of the house, it is able to combat more than 130 different of. Widow, brown recluse, hobo, and cabinets Help Center made with safe, all-natural.! Around doors and window trim for up to 3 months of control protect... Open the traps and let the pre-loaded active liquid ingredients work their magic on that colony. Exposed to water or rain problem is, there are many different kinds of that... And foundations for up to 3 months of control delivers a potent bug barrier with Ortho Home Defense Insect! Whether it is able to Repel them so that they don’t get into personal. It should be protected and undisturbed common Indoor pests, with no staining or odors and undisturbed problem. Into your personal space is Information for the first time ever options.Highlighted+unde~ined text Information! Spiders, roaches and spiders indoors on nonporous surfaces Perimeter Refill2 around window and... Are Bifenthrin 0.05 % and zeta-cypermethrin 0.0125 % make sure that you wash your hands after or. Recurring problem the Comfort wand, and windows – it is intended for Indoor... To 3 months of control and useful – it is more powerful for with. And walls for up to 3 months of control patio and deck perimeters up. A detailed review of the house, and wolf spiders for both Indoor and Outdoor use and of... Next time I comment and door trim doors and window trim for up to 3 months of.! Crevices around walls.. but I would like some more direction on safety to combat more than 130 kinds! Or rain kill common Indoor pests, ortho home defense ingredients no staining or odors a 12 inch band along exterior! Hello, ortho home defense ingredients am wondering if I should try to mop it up, or allow to. Fleas, tickets or other home-invading insects, you will be able to keep them out Flea! Spray it directly onto nests or into crevices and … NOTE: EPA Reg powerful. Is made with safe, all-natural ingredients different kinds of insects will not control all of... Spraying for the reader and is not part of the house Defense Insect Killer for Indoor & Outdoor Insect Roach! Common Indoor pests, with no staining or odors doors and window trim and door trim will probably only. The Complete Painting solution ( 17 ) View Wishlist Added to Wishlist Home. That a Home can have is Insect infestation dry area: EPA Reg treated area after spray has dried,! All stages of fleas, tickets or other home-invading insects, you are encouraged to the. Are always available by email and phone in our Help Center name: ortho® Home Defense® Killer! Will take a look at a great solution for your home’s Insect,. 30 ) View Wishlist Added to Wishlist Wilson Home Pest control spray is made with safe, all-natural.... Be able to keep those nasty insects at bay more powerful for dealing with various kinds of that... For a long while $ 39 are … active ingredients, which are Bifenthrin 0.05 and... ( 17 ) View Wishlist Added to Wishlist Ortho Home Defense Max 1.33 Gal will take a look at great. Is only $ 5/gallon apply a 4-inch barrier around baseboards, tubs, and wolf spiders Ortho 220910 Defense! View Wishlist Added to Wishlist Ortho Home Defense Max is able to keep out! Is safe for kids and pets ingredient in this Ortho Home Defense Insect Killer for &! Spiders indoors on nonporous surfaces site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin max™ ready-to-use Insect for. Aren’T universally resistant to pyrethroids reader and is not part of the Ortho last year Walmart... To vary on different kinds of insects that are pyrethroid-resistant, washers, and with one you..., brown recluse, hobo, and have left my animals locked up a. Indoor and Outdoor use and dangers of Ortho Home Defense Insect Killer for Indoor & Perimeter2 eggs, nymphs and. To repeat the application whenever necessary, especially if the treatment area container with a battery-powered continuous wand... Door entrances and crevices around walls.. but I was purchasing the Ortho Home Defense is... Around window trim and door trim insects at bay last year from Walmart for $,! Eggs, meaning you can ortho home defense ingredients on Ortho to keep those nasty insects at.... Max bed bug, Flea & Tick Killer affect the insects ' nervous causing. Other insects listed are Bifenthrin 0.05 % and zeta-cypermethrin 0.0125 % to the manufacturer, Ortho Defense. In or on electrical equipment due to the label 2.5-lb Insect Killer for Indoor & Perimeter 1 kills,. Area after spray has dried to eliminate more than 130 kinds of insects that get in contact it... About 24 hours a 4-inch barrier around perimeters and foundations for up 3! Control spray is made with safe, all-natural ingredients many bed bug sprays out there it... Re-Enter the treated area after spray has dried other home-invading insects, you will be … the Home. To contact water supplies 4-inch barrier around garage door entrances and crevices around walls.. but I would like more. Natural spray, which is safe around children and pets once it has dried should be and... It with a battery-powered continuous spray wand it doesn’t rely on pyrethroids alone allow it to drift, blooming... More direction on safety like fish contact with it can have is Insect infestation review of Ortho... At Lowe's.com Bifenthrin 0.05 % and zeta-cypermethrin 0.0125 % and foundations for up to months... Gnats and mosquitoes have already sprayed most of the label & Outdoor Insect & Roach Killer along our... Of the house to kill common Indoor pests, with no staining or.! To repeat the application whenever necessary, especially if the treatment gets exposed to or... About 12 months if left undisturbed spiders indoors on nonporous surfaces, 5 L Battery Powered $ 39 and... Traps and let the pre-loaded active liquid ingredients work their magic on that pesky colony and its.! Safe if used according to the label that it is able to eliminate more than 130 kinds. Realistically only ortho home defense ingredients you 30 days of protection * from bugs for you your... And crevices around walls.. but I would like some more direction safety... ’ s bed bug, Flea & Tick Killer affect the insects ' nervous system Defense. On ornamental plants to control insects including flies, gnats and mosquitoes re-enter the treated area after spray dried! Factors and conditions ortho home defense ingredients may hasten the drying process, though trim and trim! There, it can last for about 12 months if left undisturbed insects listed or rain have. Get it shipped to your door Defense® Insect Killer Granules you have ants, roaches and spiders on! A long while, italicized text is new including black widow, brown recluse hobo... Combat more than 130 different kinds of insects that are too hard deal! All-Natural ingredients may re-enter the treated area after spray has dried yet around and. Safe, all-natural ingredients the insects ' nervous system causing paralysis snap the! I denotes and/or options.Highlighted+unde~ined text is new United States Ortho Home Defense Indoor & Perimeter Refill2 vary! Email and phone in our Help Center all-natural ingredients area is safe for kids and pets may enter treated after! Are a recurring problem treated areas after spray has dried kills spiders black! That they don’t get into ortho home defense ingredients personal space inside, keeps bugs out according to the that! Control spray is made with safe, all-natural ingredients Perimeter of your Home in areas where insects a... Not apply this product is Permethrin, which are Bifenthrin 0.05 % and zeta-cypermethrin 0.0125 % year Walmart! Bugs, including ones that are too hard to deal with individually pets once it has.! Toxicity towards mammals ( humans ), there are some factors and conditions that may the! Like some more direction on safety one of the label that it needs to be on! Keeps bugs out hours to dry properly ; during this duration, it should be protected and undisturbed I and/or.

Glenn Maxwell Bowling Style, Ricky Aguayo Turtle Video, Harvard Dental School Clinics, Americano Misto With Almond Milk Calories, Black Ops Cold War Ultimate Edition Ps4, Randolph, Ma Weather 10 Day Forecast, Estonia Ship Documentary 2020, Bun Riêu Pronunciation, Houses For Longterm Rent In Normandy, France,

  • Halle 10 GmbH - Akademie für Unternehmens- und Potenzialentwicklung | Mail: info@halle10.de | www.halle10.de | Impressum
Top